PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr009823.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 372aa    MW: 41226.8 Da    PI: 7.0239
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr009823.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.12.7e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv ++++ G g+W++++   g+ R+ k+c++rw +yl
      Pbr009823.1 14 KGPWTPEEDIILVSYIQERGAGNWRSVPTNTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding48.12.6e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T  E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
      Pbr009823.1  67 RGNFTDHEEKMIIHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.219961IPR017930Myb domain
SuperFamilySSF466893.55E-2911108IPR009057Homeodomain-like
SMARTSM007172.4E-111363IPR001005SANT/Myb domain
PfamPF002495.7E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-221568IPR009057Homeodomain-like
CDDcd001671.50E-91661No hitNo description
PROSITE profilePS5129423.5162116IPR017930Myb domain
SMARTSM007174.0E-1566114IPR001005SANT/Myb domain
PfamPF002491.0E-1367112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2469117IPR009057Homeodomain-like
CDDcd001671.07E-1069111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MGRPPCCDKL GMKKGPWTPE EDIILVSYIQ ERGAGNWRSV PTNTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TDHEEKMIIH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLKKLQ  120
TGLDGHDHHN DQDGFSGDSL DQPISKGQWE RRLQTDIHMA KQALSEALSI NKPSIISTSA  180
TTSHDLHLQA LKPSINIGNY NINDNPITST RPHQASTYAS NTDNIAKLLK NWMKNSPKVS  240
THQTNADQTN ADQINSFNNN NKGGTTTNRG CSMSTSSEGA HSAATTPDQA FDSLFSFNSS  300
PSDVSQSMSV DENNANFTAD QTSCLFQDES KPNLEGQVPL TLLEKWLCDD AALHAHEDLI  360
NMSFENGAGL F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-23141167108B-MYB
1h8a_C3e-231211625128MYB TRANSFORMING PROTEIN
1mse_C3e-23141164105C-Myb DNA-Binding Domain
1msf_C3e-23141164105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0016700.0KM001670.1 Pyrus x bretschneideri transcription factor MYB31 (MYB31) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009368240.10.0PREDICTED: myb-related protein 306-like
SwissprotP813921e-125MYB06_ANTMA; Myb-related protein 306
TrEMBLD9ZJ590.0D9ZJ59_MALDO; MYB domain class transcription factor
STRINGVIT_17s0000g06190.t011e-137(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101634115
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.11e-100myb domain protein 94